Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MERAFQNRCEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEYKRKKA 3L32 Chain:A ((90-133)) -NLLFQSYLDNVGVQIVRQMRS-----------GERFLKIWSQTVEEIVSYVTVNF

General information: TITO was launched using: RESULT: Template: 3L32.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 61 -5822 -95.44 -132.32 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -95.44 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.546

(partial model without unconserved sides chains): PDB file : Tito_3L32.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3L32-query.scw PDB file : Tito_Scwrl_3L32.pdb: