Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL 3B64 Chain:A ((90-110)) ----------IVADRIFVLYFS------PLHCGWNGT------------------------------------------

General information: TITO was launched using: RESULT: Template: 3B64.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 -805 -805.00 -38.33 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -805.00 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.175

(partial model without unconserved sides chains): PDB file : Tito_3B64.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3B64-query.scw PDB file : Tito_Scwrl_3B64.pdb: