Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIIAAYLVLINLCGFWVMGIDKRKAQQHKWRISE--DRLWLIAIVFGALGVWLGMQTFRHKTKHASFKYGVPLLLVIEAILIAIYYSPFDL 2MP8 Chain:A ((1-64)) --LTANL-----------GISSYAAKKVIDIINTGSAVATIIALVTAVVGGGLITAGIVATAKSLIKKYG------------AKYAAAW--

General information: TITO was launched using: RESULT: Template: 2MP8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 231 -18850 -81.60 -304.02 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -81.60 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.214

(partial model without unconserved sides chains): PDB file : Tito_2MP8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MP8-query.scw PDB file : Tito_Scwrl_2MP8.pdb: