Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSYCGTCMESLFALVNGEVVMGE----TPAELVENIYTFIEENPMF 4DVC Chain:A ((148-183)) ------------------------------------------LTGVPAVVVNNRYLVQGQSAKSLDEYFDLVNYLLTL----

General information: TITO was launched using: RESULT: Template: 4DVC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 45 -15050 -334.43 -470.30 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -334.43 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.362

(partial model without unconserved sides chains): PDB file : Tito_4DVC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4DVC-query.scw PDB file : Tito_Scwrl_4DVC.pdb: