Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAFDKQKLDVTNDVTGRFQNGRLSLYHDNEMIGQMTSMNEYELKSGYSFENEKFYKTADVVSGDDAKYVDCDYENGWC 5FN7 Chain:A ((118-171)) ----------TQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTD--------------

General information: TITO was launched using: RESULT: Template: 5FN7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 151 -2692 -17.82 -49.84 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : -17.82 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.75 QMean score : -0.025

(partial model without unconserved sides chains): PDB file : Tito_5FN7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FN7-query.scw PDB file : Tito_Scwrl_5FN7.pdb: