Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPNKSKPNRLIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGYSTTCHWWPGIIKSCGTPLKDNRSHFKR 1XFL Chain:A ((9-54)) -----------------------IACHTVETWNEQLQKANESKTLVVVDFT-ASWCGPCRFIAPFFADLA---------

General information: TITO was launched using: RESULT: Template: 1XFL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 66 -7059 -106.95 -153.45 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -106.95 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.265

(partial model without unconserved sides chains): PDB file : Tito_1XFL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1XFL-query.scw PDB file : Tito_Scwrl_1XFL.pdb: