Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------------MTIDPDQIRAEIDALLASLPDPADA-ENGPSLAELEGIARRLSEAHEVLLAALESAEKG
2LQG Chain:A ((907-1044))GIDPFTLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEA


General information:
TITO was launched using:
RESULT:

Template: 2LQG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -11361 for 322 contacts (-35.3/contact) +
2D Compatibility (PS) -6528 + (NN) -4494 + (LL) 0
1D Compatibility (HY) -400 + (ID) 450
Total energy: -23233.0 ( -72.15 by residue)
QMean score : 0.614

(partial model without unconserved sides chains):
PDB file : Tito_2LQG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2LQG-query.scw
PDB file : Tito_Scwrl_2LQG.pdb: