Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHTCPRCDSKKGEVMSKSPVEGAWEVYQCQTCFFTWRSCEPESITNPEKYNPAFKIDPKETETAIEVPAVPERKA 1WII Chain:A ((25-76)) --TCPFCNHEKSCDVKMDRA-RNTGVISCTVCLEEFQTPITYLSEPVDVYSDWID--------------------

General information: TITO was launched using: RESULT: Template: 1WII.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 188 -4718 -25.10 -90.73 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -25.10 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.366

(partial model without unconserved sides chains): PDB file : Tito_1WII.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WII-query.scw PDB file : Tito_Scwrl_1WII.pdb: