Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYV 1NNX Chain:A ((38-66)) ------------------------TWVTLRGNIVERISDD--LYVFKDASGTINV----------------

General information: TITO was launched using: RESULT: Template: 1NNX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 58 -6248 -107.72 -215.43 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -107.72 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.782

(partial model without unconserved sides chains): PDB file : Tito_1NNX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NNX-query.scw PDB file : Tito_Scwrl_1NNX.pdb: