Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGVNIPYKISTSTNCATIRA
2ALG Chain:A ((1-92))MITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK-


General information:
TITO was launched using:
RESULT:

Template: 2ALG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -53940 for 636 contacts (-84.8/contact) +
2D Compatibility (PS) -9530 + (NN) -2498 + (LL) 144
1D Compatibility (HY) -10000 + (ID) 2800
Total energy: -78624.0 ( -123.62 by residue)
QMean score : 0.511

(partial model without unconserved sides chains):
PDB file : Tito_2ALG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2ALG-query.scw
PDB file : Tito_Scwrl_2ALG.pdb: