Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------MHDIDKQLQEQVNNLDRTEKSAAELERKIQEHKEEFMKKEKKQTTGR--DKYRAYKKEQNSF---------------------
1HX1 Chain:B ((1-112))GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE


General information:
TITO was launched using:
RESULT:

Template: 1HX1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 17785 for 267 contacts (66.6/contact) +
2D Compatibility (PS) -6768 + (NN) -3773 + (LL) 0
1D Compatibility (HY) -2400 + (ID) 450
Total energy: 4394.0 ( 16.46 by residue)
QMean score : 0.567

(partial model without unconserved sides chains):
PDB file : Tito_1HX1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1HX1-query.scw
PDB file : Tito_Scwrl_1HX1.pdb: