Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------MSKTVVRKN---ESLEDALRRFKRTVSKSGTLQESRKREFYEKPSVKRKKKSEAARKRKF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1HYN Chain:P ((56-348))KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ


General information:
TITO was launched using:
RESULT:

Template: 1HYN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 9524 for 262 contacts (36.4/contact) +
2D Compatibility (PS) -6330 + (NN) -2146 + (LL) 0
1D Compatibility (HY) -3200 + (ID) 350
Total energy: -2502.0 ( -9.55 by residue)
QMean score : 0.628

(partial model without unconserved sides chains):
PDB file : Tito_1HYN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1HYN-query.scw
PDB file : Tito_Scwrl_1HYN.pdb: