Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSLPKDLLYTEEHEWVKADDGSYVIGITDFAQDQLGDIVFVELPEVGDTVTKGDSIGSIESVKTVSDFYAPVTGKVVAVNETLEDEPELINSNPYDTGWILKLEEVEEADVKALLSSDDYEKVLD
1HPC Chain:B ((7-125))------LKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCE


General information:
TITO was launched using:
RESULT:

Template: 1HPC.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -51571 for 927 contacts (-55.6/contact) +
2D Compatibility (PS) -12535 + (NN) -722 + (LL) 204
1D Compatibility (HY) -10800 + (ID) 2800
Total energy: -78224.0 ( -84.38 by residue)
QMean score : 0.674

(partial model without unconserved sides chains):
PDB file : Tito_1HPC.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1HPC-query.scw
PDB file : Tito_Scwrl_1HPC.pdb: