Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKLTKEELIFLVKELMNPTLDDEKVSEYLDLLEKNVPYPAPSDLIFWSNE--DYTAEQVVKIALNYKDE 1GXG Chain:A ((8-76)) -SDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAA

General information: TITO was launched using: RESULT: Template: 1GXG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 216 -24204 -112.05 -361.25 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -112.05 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.825

(partial model without unconserved sides chains): PDB file : Tito_1GXG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1GXG-query.scw PDB file : Tito_Scwrl_1GXG.pdb: