Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLFFPWWVYLCIVGIIFSAYKLVAAAKEEEKVDQAFIEKEGQIYMERMEKERERRSSQQHEEENQNHSIA 2A5Y Chain:A ((124-141)) ----------LIGLISFGGFVAAKMMES------------------------------------------

General information: TITO was launched using: RESULT: Template: 2A5Y.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -848 -424.00 -47.11 target 2D structure prediction score : 0.89 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -424.00 2D Compatibility (Sec. Struct. Predict.) : 0.89 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.300

(partial model without unconserved sides chains): PDB file : Tito_2A5Y.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2A5Y-query.scw PDB file : Tito_Scwrl_2A5Y.pdb: