Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK 1WP7 Chain:A ((143-484)) NINKLKSSIESTNEAVVKLQETAEKTVYVLTALQDISSQISSMNQSLQQSKDYIKEAQRLLDTV

General information: TITO was launched using: RESULT: Template: 1WP7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 54 5928 109.77 126.12 target 2D structure prediction score : 0.13 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : 109.77 2D Compatibility (Sec. Struct. Predict.) : 0.13 1D Compatibility (Hydrophobicity) : 0.61 QMean score : -0.282

(partial model without unconserved sides chains): PDB file : Tito_1WP7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WP7-query.scw PDB file : Tito_Scwrl_1WP7.pdb: