Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEGWPKQ 2EDU Chain:A ((52-78)) --------------------------------KAQLIVGWRELHGPFSQVEDLERVEGI-----

General information: TITO was launched using: RESULT: Template: 2EDU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 46 -6034 -131.16 -223.46 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -131.16 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.647

(partial model without unconserved sides chains): PDB file : Tito_2EDU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2EDU-query.scw PDB file : Tito_Scwrl_2EDU.pdb: