Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEEKYETNGYDTSIVYDYKEYPDVKYGRCDNCDYTLFKSS-VKSGIFLRECRRCGMKKSI 3QT1 Chain:I ((26-55)) ---------------------------FCRDCNNMLYPREDKENNRLLFECRTCSYV---

General information: TITO was launched using: RESULT: Template: 3QT1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 64 -2021 -31.57 -69.67 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain I : 0.60 3D Compatibility (PKB) : -31.57 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.381

(partial model without unconserved sides chains): PDB file : Tito_3QT1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QT1-query.scw PDB file : Tito_Scwrl_3QT1.pdb: