Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEKK 1WAP Chain:V ((8-74)) -------DFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEK-

General information: TITO was launched using: RESULT: Template: 1WAP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain V - contact count / total energy / energy per contact / energy per residue : 280 -18925 -67.59 -282.46 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain V : 0.97 3D Compatibility (PKB) : -67.59 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.97 QMean score : 0.660

(partial model without unconserved sides chains): PDB file : Tito_1WAP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WAP-query.scw PDB file : Tito_Scwrl_1WAP.pdb: