Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEIAIIALFIVSIALIAFSYSQRDPMKDVEQELETLQLSAMQEIYKLKKKMTVLEEELLETNLVIRKSKQNDINQKIAKQILSKYNNGMSAEAIAKAEHVSVEDVNTIIKDNEKVLV 2R0Q Chain:C ((163-199)) ---------------------------------------------------------------------------VIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDN-----

General information: TITO was launched using: RESULT: Template: 2R0Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 89 -15035 -168.93 -406.35 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain C : 0.56 3D Compatibility (PKB) : -168.93 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.712

(partial model without unconserved sides chains): PDB file : Tito_2R0Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2R0Q-query.scw PDB file : Tito_Scwrl_2R0Q.pdb: