Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------MITQLYRERTAAD-----LKNRISKVLLNG---NETEIVELTIQGAVVTVLTQREEDIKHIKSVQILDDQNNVITERTTDLDVSNNRTLDFRITFEVV-----------------------------------------------------------
4K6L Chain:G ((1-224))VDFVYRVDSTPPDVIFRDGFSLLGYNRNFQQFISGRSCSGGSSDSRYIATTSSVNQTYAIARAYYSRSTFKGNLYRYQIRADNNFYSLLPSITYLETQGGHFNAYEKTMMRLQREYVSTLSILPENIQKAVALVY-DSATGLVKDGVSTMN-ASYLGLSTTSNPGVIPFLPEPQTYTQQRIDAFGPLISSCFSIGSVCHSHRGQRADVYNMSFYDARPVIELILSK


General information:
TITO was launched using:
RESULT:

Template: 4K6L.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 250 4133 16.53 46.97
target 2D structure prediction score : 0.40
Monomeric hydrophicity matching model chain G : 0.55

3D Compatibility (PKB) : 16.53
2D Compatibility (Sec. Struct. Predict.) : 0.40
1D Compatibility (Hydrophobicity) : 0.55
QMean score : 0.229

(partial model without unconserved sides chains):
PDB file : Tito_4K6L.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4K6L-query.scw
PDB file : Tito_Scwrl_4K6L.pdb: