Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQELNNQKDDPINYTESELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKGE 4NPD Chain:A ((15-43)) ---------------------------------------------------------EILHLPNLTEEQRNGFIQSLKDDPSVSKE-----------------

General information: TITO was launched using: RESULT: Template: 4NPD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 33 -2259 -68.45 -77.90 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -68.45 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.627

(partial model without unconserved sides chains): PDB file : Tito_4NPD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4NPD-query.scw PDB file : Tito_Scwrl_4NPD.pdb: