Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNPETMNKTLISISKWGKATGILFIIMGAITALSGAFFFLIGAVPGVLQIISGIFLMRSAREAGQMAEHNSGQSEDLMLENYAKFVKMQGIYLIVSIAVSILAIIAFFIFLMLGIADGLFSDTYSTY 2W0C Chain:P ((1-65)) MNTSVPTSVPTNQSVWGN--------------VSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGAAVVVE------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2W0C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 22 -477 -21.68 -7.34 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain P : 0.48 3D Compatibility (PKB) : -21.68 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.48 QMean score : -0.049

(partial model without unconserved sides chains): PDB file : Tito_2W0C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2W0C-query.scw PDB file : Tito_Scwrl_2W0C.pdb: