Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKEKLSDHLKSEWKKIDQTANPSIPNQKELL---HQLSQMKAEYRKKLLQEIILFVFCALMVVSAAILAFTQAPAVFIVLQVCVLAVLPILIAAEKKRHLGECEVKRG 5FVD Chain:B ((1-28)) ----------------------MSFPEGKDILFMGNEAAKLAEAFQKSLR-----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5FVD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 12 -108 -8.96 -4.30 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain B : 0.53 3D Compatibility (PKB) : -8.96 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.808

(partial model without unconserved sides chains): PDB file : Tito_5FVD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FVD-query.scw PDB file : Tito_Scwrl_5FVD.pdb: