Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVYQTKRDVPVTLMIVFLILLIQADAIVPFVLGNMRVSGWIIFILLTLLNGLIIWSFIDLKYVLKEHHLIIKAGLIKHQIPYENIDKVVQKKKLWSGFRLIGSRHAITIYYQGGWGHAVISPQKSEEFIHKLKEKNSNIIIFTKSK 3TN2 Chain:A ((17-57)) ----------------------------------------------------------------------------ARKLPRNFVVDYYETS-----S--LCSQPAVVFQTKR-SKQVCADPSES---------------------

General information: TITO was launched using: RESULT: Template: 3TN2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 97 -10661 -109.91 -260.02 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.47 3D Compatibility (PKB) : -109.91 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.47 QMean score : 0.605

(partial model without unconserved sides chains): PDB file : Tito_3TN2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3TN2-query.scw PDB file : Tito_Scwrl_3TN2.pdb: