Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSYYNKRNQEPLPKEDVSTWECTKEDCNG-WTRKN-FASSDTPLCPLCGSKMVDGIRSLVNLQNNSQTKTS 1M2K Chain:A ((117-158)) --------------GSLRVVRCTS--CNNSFEVESAPKIPPLPKCDKCGSLLRPGVVW-------------

General information: TITO was launched using: RESULT: Template: 1M2K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 104 -5950 -57.21 -148.74 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -57.21 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.431

(partial model without unconserved sides chains): PDB file : Tito_1M2K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1M2K-query.scw PDB file : Tito_Scwrl_1M2K.pdb: