Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------------------------------------------------------MCKLCQTKKVIVEHTGIGVVFHPCPNCRSGTDLTPVIQKLEQMLTAGKA---RLNIYD--------------------------------------------------
7ODC Chain:A ((44-296))DLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATKFGATLKTSRLLLERAKELNIDVI----GVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASA


General information:
TITO was launched using:
RESULT:

Template: 7ODC.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 97 -20649 -212.87 -404.87
target 2D structure prediction score : 0.65
Monomeric hydrophicity matching model chain A : 0.53

3D Compatibility (PKB) : -212.87
2D Compatibility (Sec. Struct. Predict.) : 0.65
1D Compatibility (Hydrophobicity) : 0.53
QMean score : 0.562

(partial model without unconserved sides chains):
PDB file : Tito_7ODC.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-7ODC-query.scw
PDB file : Tito_Scwrl_7ODC.pdb: