Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKGNEAEVIQIMSTNPMHFLHPDISPGQKLKLNV 3KTP Chain:B ((8-17)) ---------------------------------------------------------PEFHPGVPWK---

General information: TITO was launched using: RESULT: Template: 3KTP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 9 656 72.83 65.55 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain B : 0.52 3D Compatibility (PKB) : 72.83 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 1.565

(partial model without unconserved sides chains): PDB file : Tito_3KTP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KTP-query.scw PDB file : Tito_Scwrl_3KTP.pdb: