Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceATTCAPTQLTPCAPAIVGNAAPTAACCARLKAHPATCFCQYKRNPSMQRYVNSPNGKKVFAACKVSLPRC
1L6H Chain:A ((1-68))-AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQ-QGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTC


General information:
TITO was launched using:
RESULT:

Template: 1L6H.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -43461 for 515 contacts (-84.4/contact) +
2D Compatibility (PS) -7064 + (NN) -7130 + (LL) 4
1D Compatibility (HY) -6800 + (ID) 1700
Total energy: -66151.0 ( -128.45 by residue)
QMean score : 0.322

(partial model without unconserved sides chains):
PDB file : Tito_1L6H.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1L6H-query.scw
PDB file : Tito_Scwrl_1L6H.pdb: