Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------MSKTVVRKN---ESLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVKRKKKSEAARKRKFK------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1HYN Chain:P ((56-348))KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ


General information:
TITO was launched using:
RESULT:

Template: 1HYN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 9076 for 264 contacts (34.4/contact) +
2D Compatibility (PS) -6354 + (NN) -1656 + (LL) 0
1D Compatibility (HY) -2800 + (ID) 450
Total energy: -2184.0 ( -8.27 by residue)
QMean score : 0.569

(partial model without unconserved sides chains):
PDB file : Tito_1HYN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1HYN-query.scw
PDB file : Tito_Scwrl_1HYN.pdb: