Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQLCVALDLEKKEDNLSLLQELKGLDLWAKVGLRSFIRDGATFLDEIRKIDGNFKIFLDLKLYDIPYTMANAALECAKLDIDMLTVHLSSAKSALTILMQRLNALKKRPLIMGVSALTSFSEEEFLMVYNAPLKTQAITLSAIGKESGIDGVVCSVFESLAIKEALGKGFLTLTPGIRLDKNDKEDQERVANAKEAKQNLSDFIVVGRPIYQAKEPREVVLELLKDC
3RU6 Chain:C ((25-247))MKLCVALDLSTKEECLQLAKELKNLDIWLKVGLRAYLRDGFKFIEELKKVD-DFKIFLDLKFHDIPNTMADACEEVSKLGVDMINIHASAGKIAIQEVMTRLSKFSKRPLVLAVSALTSFDEENFFSIYRQKIEEAVINFSKISYENGLDGMVCSVFESKKIKEHTSSNFLTLTPGIRPFG---------ANLAMARENLSDYIVVGRPIYKNENPRAVCEKILNKI


General information:
TITO was launched using:
RESULT:

Template: 3RU6.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -169876 for 1745 contacts (-97.4/contact) +
2D Compatibility (PS) -23525 + (NN) -11672 + (LL) 280
1D Compatibility (HY) -25600 + (ID) 5850
Total energy: -236243.0 ( -135.38 by residue)
QMean score : 0.673

(partial model without unconserved sides chains):
PDB file : Tito_3RU6.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3RU6-query.scw
PDB file : Tito_Scwrl_3RU6.pdb: