Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMEIKMAKDYGFCFGVKRAIQIAEK-----NQNSLIFGSLIHNAKEINRLEKN-FNVKIEEDPKKIPKNKSVIIRTHGIPKQDLEYLKNKGVKITDATCPYVIKPQQIVESMSKEGYQIVLFGDINHPEVKGVISYAT---NQALVVNSLEELQEKKLQRKVALVSQTTKQTPKLLQIASYLVERCTEVRIFNTICNATSYNQKAALDLSKEVDIMIVVGGKTSSNTKQLLSIAKQHCKDSYLVEDENELELAWFKDKKLCGITAGASTPDWIIENVKQKISTI
3DNF Chain:A ((2-280))VDIIIAEHAGFCFGVKRAVKLAEESLKESQGKVYTLGPIIHNPQEVNRLKNLGVFPSQ---GEEFKEGDTVIIRSHGIPPEKEEALRKKGLKVIDATCPYVKAVHEAVCQLTREGYFVVLVGEKNHPEVIGTLGYLRACNGKGIVVETLEDIGEALKHERVGIVAQTTQNEEFFKEVVGEIALWVKEVKVINTICNATSLRQESVKKLAPEVDVMIIIGGKNSGNTRRLYYISKELNPNTYHIETAEELQPEWFRGVKRVGISAGASTPDWIIEQVKSRIQEI


General information:
TITO was launched using:
RESULT:

Template: 3DNF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -131798 for 2197 contacts (-60.0/contact) +
2D Compatibility (PS) -29027 + (NN) -7208 + (LL) 132
1D Compatibility (HY) -23200 + (ID) 5700
Total energy: -196801.0 ( -89.58 by residue)
QMean score : 0.603

(partial model without unconserved sides chains):
PDB file : Tito_3DNF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3DNF-query.scw
PDB file : Tito_Scwrl_3DNF.pdb: