Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN---- 1X4I Chain:A ((1-70)) GSSGSSGY---------------CICNQVSYGEMVG-CDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHKSGPSSG

General information: TITO was launched using: RESULT: Template: 1X4I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 186 -43945 -236.26 -665.83 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -236.26 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.244

(partial model without unconserved sides chains): PDB file : Tito_1X4I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1X4I-query.scw PDB file : Tito_Scwrl_1X4I.pdb: