Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRDQEKIQIENEMNAMHGTIKEDILKDFEEFKGYLKKQVNRGKKLGLDDGKLVKSAAILGDYLAKHEEPQNGEEMLLQELWSVADEDEKEHLAQLLVKLVDKQ 5AON Chain:A ((27-53)) ----------------------------------PTSSKVHFLKSKGLSAEEICEAFTKVG-------------------------------------------

General information: TITO was launched using: RESULT: Template: 5AON.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 37 -2635 -71.22 -97.59 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -71.22 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.765

(partial model without unconserved sides chains): PDB file : Tito_5AON.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AON-query.scw PDB file : Tito_Scwrl_5AON.pdb: