Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------------------------------------------------------------------------------MKEKKSYTELMKSRNTQKTKEFDVTMTDIYIQMVLDESLYNRRLAMLTDQINKALDEKDKDAFLTLSKEYAALKQSE 3DO9 Chain:A ((4-182)) PVSVNEKKDFVKWFLNNYQLKQRECVWILNYLMSHDQLMHKVHFVEHAKYCPRGLVMSANCVKDTPFHFFKQNVMTTDAEKSFHDIRLNRDEDIYIQLNFKSSFQNANYVAVLEENPYLPKHIEVNEKDRLLAERFLEESVFSFRRERLLKQIDEALDKQDKEAFHRLTAELKMLEGHH

General information: TITO was launched using: RESULT: Template: 3DO9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 137 -5333 -38.93 -69.26 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -38.93 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.482

(partial model without unconserved sides chains): PDB file : Tito_3DO9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DO9-query.scw PDB file : Tito_Scwrl_3DO9.pdb: