Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRLVEENKLKQKLGHKQADSILTLLKLANEKHITL 2JUB Chain:A ((1-76)) ATLTSEVIKANKG-------------REGKPMISLVDGEEIKGTVYLGDGWSAKKDGATIVISPAEETALFKAKHISAAHLKIIAKNLL---

General information: TITO was launched using: RESULT: Template: 2JUB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 277 17464 63.05 229.78 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : 63.05 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.007

(partial model without unconserved sides chains): PDB file : Tito_2JUB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JUB-query.scw PDB file : Tito_Scwrl_2JUB.pdb: