Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKGKIPKIRNQANKVKRTPRYMEFPVTYEVYHVESGDTLWTIAKSFEIPVQQLMNLNKLSSDRIYPGQIIKI--RER 4UZ3 Chain:B ((5-51)) ------------------------------YTVAPGDTLYSIARRYGTTVEELMRLNGLESFLLQPGQVLKLPSRER

General information: TITO was launched using: RESULT: Template: 4UZ3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 129 -26433 -204.91 -587.40 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.73 3D Compatibility (PKB) : -204.91 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.609

(partial model without unconserved sides chains): PDB file : Tito_4UZ3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4UZ3-query.scw PDB file : Tito_Scwrl_4UZ3.pdb: