Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKKMRKRSFHELVMENKKELMTNTEYLNQLEEKLEQRFKQK--
2UVH Chain:A ((5-408))EVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQK----TVQETAEYFNKQGDRILKRAMR


General information:
TITO was launched using:
RESULT:

Template: 2UVH.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 64 4780 74.68 129.18
target 2D structure prediction score : 0.84
Monomeric hydrophicity matching model chain A : 0.51

3D Compatibility (PKB) : 74.68
2D Compatibility (Sec. Struct. Predict.) : 0.84
1D Compatibility (Hydrophobicity) : 0.51
QMean score : 0.532

(partial model without unconserved sides chains):
PDB file : Tito_2UVH.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2UVH-query.scw
PDB file : Tito_Scwrl_2UVH.pdb: