Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------MTEIKANSTVMIHVLAD----------ETLSSIKREYVEVDRKTEIGEKI--IIVDKNDPDDEYENGAI-- 2AHM Chain:A ((2-78)) PLGSSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCE

General information: TITO was launched using: RESULT: Template: 2AHM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output QMean score : ?

(partial model without unconserved sides chains): PDB file : Tito_2AHM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2AHM-query.scw PDB file : Tito_Scwrl_2AHM.pdb: