Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMIHKNWLEKE--TIKKVKCVQ-------------TNAKK-YIVNRVLTPGK-----EYEVKNETEEF-LFVVDNTN-KVGGYYKEYFEEM
3G1J Chain:A ((0-89))GVDRDYLQSEYGVLKAGQCYKVVRSFRDYRNINYERGDVMRFLGSNFVPYESGLSLFFDKNGSERQIMLCVRPEFQMEIAHHLDSYFCKL


General information:
TITO was launched using:
RESULT:

Template: 3G1J.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 234 17071 72.95 254.79
target 2D structure prediction score : 0.40
Monomeric hydrophicity matching model chain A : 0.66

3D Compatibility (PKB) : 72.95
2D Compatibility (Sec. Struct. Predict.) : 0.40
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.238

(partial model without unconserved sides chains):
PDB file : Tito_3G1J.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3G1J-query.scw
PDB file : Tito_Scwrl_3G1J.pdb: