Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEMDITQYLSTQGPFAVLFCWLLFYVMKTSKERESKLYNQIDSQNEVLGKFSEKYDVVIEKLDKIEQNFK 1JSD Chain:B ((49-84)) ---------------------------------TSKVNNIVDKMNKQYGIIDHEFSEIETRLNMINNKI-

General information: TITO was launched using: RESULT: Template: 1JSD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 23 1570 68.24 43.60 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : 68.24 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.276

(partial model without unconserved sides chains): PDB file : Tito_1JSD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JSD-query.scw PDB file : Tito_Scwrl_1JSD.pdb: