Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFSENLKKCRKQKKLTQQNMADKLGITRPAYTAYELGSREPDYKTLINISNILDVSLDYLLKGESNEKVFQDEAKKVLNDPETFLAAKDGEVTDEILQAALEIITEQLKERRKSDK 3JXC Chain:R ((4-67)) LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLKGD----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3JXC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 236 -22287 -94.44 -348.23 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain R : 0.75 3D Compatibility (PKB) : -94.44 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.716

(partial model without unconserved sides chains): PDB file : Tito_3JXC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3JXC-query.scw PDB file : Tito_Scwrl_3JXC.pdb: