Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------MEESHAVREMIKIIAKWDPFKYGEEFYETEAVDVVQAVYDENDPDLLAKSIQQIFETSFEQTLPIASCREVAGQLLFIKNSSSCTP-----------------------------------------------------------------------------------------------------------------------------------------------------------
2HUO Chain:A ((32-289))FRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSY-KKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTA-EGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW


General information:
TITO was launched using:
RESULT:

Template: 2HUO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 131 7069 53.96 84.15
target 2D structure prediction score : 0.57
Monomeric hydrophicity matching model chain A : 0.55

3D Compatibility (PKB) : 53.96
2D Compatibility (Sec. Struct. Predict.) : 0.57
1D Compatibility (Hydrophobicity) : 0.55
QMean score : 0.181

(partial model without unconserved sides chains):
PDB file : Tito_2HUO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HUO-query.scw
PDB file : Tito_Scwrl_2HUO.pdb: