Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNVLNKIALVTGGGTGIGKAASMELAKRGAIVAVNYSRSQSEAEETVEMIQKAGGQAFAIQADVSKNSDVQDMIQAIVNTHGTVDILVNNASITRHIPMDDLEAATEDV
3OID Chain:D ((4-107))----NKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWD-


General information:
TITO was launched using:
RESULT:

Template: 3OID.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 444 -45526 -102.54 -437.75
target 2D structure prediction score : 0.71
Monomeric hydrophicity matching model chain D : 0.79

3D Compatibility (PKB) : -102.54
2D Compatibility (Sec. Struct. Predict.) : 0.71
1D Compatibility (Hydrophobicity) : 0.79
QMean score : 0.609

(partial model without unconserved sides chains):
PDB file : Tito_3OID.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3OID-query.scw
PDB file : Tito_Scwrl_3OID.pdb: