Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNITQYEKLKQHLSDEDTGPFTLNEFSFYMKEDDRYIHIPVFE 1IMT Chain:? ((1-36)) AVITGACE-----RDLQCGKGTCCAVSLWIK--SVRVCTPVGT

General information: TITO was launched using: RESULT: Template: 1IMT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 90 -4400 -48.88 -122.21 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -48.88 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.176

(partial model without unconserved sides chains): PDB file : Tito_1IMT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IMT-query.scw PDB file : Tito_Scwrl_1IMT.pdb: