Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------------------------------------------------MDNQRQYPRTPLKCRIRISHPLFGELMAQTRDLSDTGVYVK-HPDLTQLPTGSVVTGQVQDLPIDAPI---LQMEVVRVDAEG----VGLRFLSEA----------------------
1YLN Chain:A ((23-248))TVSTINSTDALAMVEHSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFELNLAGKVLFDE-HRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLNA


General information:
TITO was launched using:
RESULT:

Template: 1YLN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -42333 for 524 contacts (-80.8/contact) +
2D Compatibility (PS) -9128 + (NN) -1263 + (LL) 132
1D Compatibility (HY) -2400 + (ID) 850
Total energy: -55842.0 ( -106.57 by residue)
QMean score : 0.433

(partial model without unconserved sides chains):
PDB file : Tito_1YLN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1YLN-query.scw
PDB file : Tito_Scwrl_1YLN.pdb: