Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)
Input alignment information:
| Query sequence | ---MCFWYHSSKKAARKEEKIDYLDNKLKMFRNIEFIVSAISLAPLIACVFCPVLSEFGLVTLGVNFLVCFVGSLAFHMKHEKKSDNIEKAKEAVNSYNTPPSYFQNPDVGNSFPSASPYGSQYFPFY |
| 3J47 Chain:P ((1-34)) | SQLLNEWSHNVDELLEHIETIGHLITKEEIMHGL---------------------------------------------------------------------------------------------- |
|
General information:
TITO was launched using:
| RESULT:
|
Template: 3J47.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
|
3D Compatibility (PKB) 5309 for 114 contacts (46.6/contact) +
2D Compatibility (PS) -3384 + (NN) -3013 + (LL) 5292
1D Compatibility (HY) -800 + (ID) 300
Total energy: 3104.0 ( 27.23 by residue)
QMean score : 0.488
|
|
|