Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
3LGM Chain:B ((3-110))MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK


General information:
TITO was launched using:
RESULT:

Template: 3LGM.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -11098 for 681 contacts (-16.3/contact) +
2D Compatibility (PS) -11613 + (NN) -2095 + (LL) 0
1D Compatibility (HY) -14000 + (ID) 5400
Total energy: -44206.0 ( -64.91 by residue)
QMean score : 0.499

(partial model without unconserved sides chains):
PDB file : Tito_3LGM.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3LGM-query.scw
PDB file : Tito_Scwrl_3LGM.pdb: