Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------------------------------------------------------------------------------------------MSANLTD-FVTKTIE---EMNSFDRENMECIKKLIRKAIDFYHLKSYEEVEETHSGNVRFLHVHSMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY----------------------------------------------
4X2Z Chain:A ((9-309))QKTIYLTEDGVKYRSIVLKPGDSLGQFGQVYAKNKIVFTADDVEDKEILYVPTTDKSILEYYGLDAQKYVIYLQTLAQKWNVQYRDNFLILEWRDGNCWISSAIVLLQAAKIRFKGFLTEAWAKLLGGDPTDFVAWCYASCTAKVGDFSDANWLLANLAEHFDADYTNAFLKKRVSCNCGIKSYELRGLEACIQPVR-ATNLLHFK-----TQYSNCPTCGANNTDEVIEASLPYLLLFATDGPATVDCDEDAVGTVVFVGSTNSGHCYTQAAGQAFDNLAKDRKFGKKSPYITAMYTRFAFKNETS


General information:
TITO was launched using:
RESULT:

Template: 4X2Z.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -13700 for 504 contacts (-27.2/contact) +
2D Compatibility (PS) -9254 + (NN) 3372 + (LL) 528
1D Compatibility (HY) -4000 + (ID) 850
Total energy: -23904.0 ( -47.43 by residue)
QMean score : 0.097

(partial model without unconserved sides chains):
PDB file : Tito_4X2Z.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4X2Z-query.scw
PDB file : Tito_Scwrl_4X2Z.pdb: