Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------MPIKKKVMMCLAVTLVFGSMSFPTLTNSGGFKESTDRNTTYIDHSPYKLSDQKKALS------------------------------------------------------------------
4KE2 Chain:A ((0-195))MNIDPAARAAAAAAASKAAVTAADAAAAAATIAASAASVAAATAADDAAASIATINAASAAAKSIAAAAAMAAKDTAAAAASAAAAAVASAAKALETINVKAAYAAATTANTAAAAAAATATTAAAAAAAKATIDNAAAAKAAAVATAVSDAAATAATAAAVAAATLEAAAAKAAATAVSAAAAAAAAAIAFAAAP


General information:
TITO was launched using:
RESULT:

Template: 4KE2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 64 -3178 -49.65 -55.75
target 2D structure prediction score : 0.47
Monomeric hydrophicity matching model chain A : 0.55

3D Compatibility (PKB) : -49.65
2D Compatibility (Sec. Struct. Predict.) : 0.47
1D Compatibility (Hydrophobicity) : 0.55
QMean score : 0.125

(partial model without unconserved sides chains):
PDB file : Tito_4KE2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4KE2-query.scw
PDB file : Tito_Scwrl_4KE2.pdb: